PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P24810_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 247aa    MW: 27195.6 Da    PI: 5.4486
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P24810_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.21.6e-191063356
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                            k+++++++q+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  GSMUA_Achr10P24810_001 10 KKRRLSADQVRALEKNFEVDNKLEPERKVRLAQELGLQPRQVAVWFQNRRARWK 63
                            45689************************************************9 PP

2HD-ZIP_I/II132.31.7e-4210101293
             HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                             kkrrls++qv++LE++Fe ++kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy+aLk++yd+l+ + ++L++++e+L 
  GSMUA_Achr10P24810_001  10 KKRRLSADQVRALEKNFEVDNKLEPERKVRLAQELGLQPRQVAVWFQNRRARWKTKQLEHDYAALKASYDQLRLDCDALRRDKESLL 96 
                             9************************************************************************************** PP

             HD-ZIP_I/II  89 eelke 93 
                             +e+ke
  GSMUA_Achr10P24810_001  97 AEIKE 101
                             99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.67565IPR001356Homeobox domain
SMARTSM003892.6E-19869IPR001356Homeobox domain
SuperFamilySSF466898.55E-20874IPR009057Homeodomain-like
PfamPF000468.4E-171063IPR001356Homeobox domain
CDDcd000869.93E-191066No hitNo description
Gene3DG3DSA:1.10.10.605.8E-211272IPR009057Homeodomain-like
PRINTSPR000319.4E-63645IPR000047Helix-turn-helix motif
PROSITE patternPS0002704063IPR017970Homeobox, conserved site
PRINTSPR000319.4E-64561IPR000047Helix-turn-helix motif
PfamPF021836.7E-1765106IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MCSGGPRGAK KRRLSADQVR ALEKNFEVDN KLEPERKVRL AQELGLQPRQ VAVWFQNRRA  60
RWKTKQLEHD YAALKASYDQ LRLDCDALRR DKESLLAEIK ELRAKLAEDG SLSFCLGKED  120
PVASDAEQKA TAPQEPPPLI CKDGSSDSDS SAVLNDAILN DDDSPRGLSS SASAPNILSV  180
AAIGYGTFSS FPASPPPLLN LDFRTLKPIG GLNHQNHAMK IEELLGVVEP CSGFFSDDQT  240
PSPNWFY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15765RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009380877.10.0PREDICTED: homeobox-leucine zipper protein HOX20-like
SwissprotQ6Z2483e-60HOX20_ORYSJ; Homeobox-leucine zipper protein HOX20
SwissprotA2YWC03e-60HOX20_ORYSI; Homeobox-leucine zipper protein HOX20
TrEMBLM0RL560.0M0RL56_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P24810_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30093482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.11e-50homeobox protein 16